Tag Archives: TransDecoder

Second look at Geoduck transcriptome

Last week I popped out a quick assembly and annotation on our geoduck gonadal transcriptome. A second assembly was also done using Trinity.


Updates
August 3 – Confirmed // in file location had no impact on assembly.
July 14 – TransDecoder protein annotations
10:40am – added TransDecoder results
10:29am – added Stats via Trinity


Trinity.pl 
--seqType fq 
-JM 24G 
--left /Volumes/web/cnidarian/Geo_Pool_F_GGCTAC_L006_R1_001_val_1.fq /Volumes/web/cnidarian/Geo_Pool_M_CTTGTA_L006_R1_001_val_1.fq 
--right /Volumes/web/cnidarian//Geo_Pool_F_GGCTAC_L006_R2_001_val_2.fq /Volumes/web/cnidarian//Geo_Pool_M_CTTGTA_L006_R2_001_val_2.fq 
--CPU 16 

trinity_out_dir_1B54203C.png

Output

0:999   127840
1000:1999   18164
2000:2999   5321
3000:3999   1817
4000:4999   762
5000:5999   291
6000:6999   135
7000:7999   73
8000:8999   22
9000:9999   29
10000:10999     4
11000:11999     5
12000:12999     3
13000:13999     4
14000:14999     4
15000:15999     3
16000:16999     0
17000:17999     2
18000:18999     1

Total length of sequence:   101862868 bp
Total number of sequences:  154480
N25 stats:          25% of total sequence length is contained in the 8095 sequences >= 2045 bp
N50 stats:          50% of total sequence length is contained in the 26158 sequences >= 1014 bp
N75 stats:          75% of total sequence length is contained in the 64574 sequences >= 446 bp
Total GC count:         37657770 bp
GC %:               36.97 %
hummingbird:Geo-trinity steven$ /Users/gilesg/compile/trinityrnaseq_r20131110/util/TrinityStats.pl /Volumes/web/cnidarian/Geo-trinity/trinity_out_dir/Trinity.fasta 


################################
## Counts of transcripts, etc.
################################
Total trinity transcripts:  154480
Total trinity components:   100155
Percent GC: 36.97

########################################
Stats based on ALL transcript contigs:
########################################

    Contig N10: 3444
    Contig N20: 2385
    Contig N30: 1766
    Contig N40: 1343
    Contig N50: 1014

    Median contig length: 371
    Average contig: 659.39
    Total assembled bases: 101862868


#####################################################
## Stats based on ONLY LONGEST ISOFORM per COMPONENT:
#####################################################

    Contig N10: 2999
    Contig N20: 2026
    Contig N30: 1462
    Contig N40: 1067
    Contig N50: 768

    Median contig length: 321
    Average contig: 553.88
    Total assembled bases: 55473621

Rerunning to see if double slash was a problem- did not see anything in error. Also running TransDecoder


TransDecoder Results

Ran the following

/Users/gilesg/compile/trinityrnaseq_r20131110/trinity-plugins/TransDecoder_r20131110/TransDecoder -t  /Volumes/web/cnidarian/Geo-trinity/trinity_out_dir/Trinity.fasta

This provided a peptide file with 36003 sequences.

!head /Volumes/web-1/cnidarian/Geo-trinity/Trinity.fasta.transdecoder.pep

>cds.comp100047_c0_seq2|m.5982 comp100047_c0_seq2|g.5982 ORF comp100047_c0_seq2|g.5982 comp100047_c0_seq2|m.5982 type:internal len:142 (-) comp100047_c0_seq2:3-425(-)
NAECRDLYKIFTQILSVRSQEGKIVIPDEFATKIRNWLGNKEELFKEAHNQKIITFYNEY
TREENTFNPIRGKRPMSVPDMPERKYIDQLSRKTQSQCDFCKYKTFTAEDTFGRIDSNFS
CSASNAFKLDHWHALFLLKTH


Running blastp on Trinity.fasta.transdecoder.pep

!blastp 
-query /Volumes/web/cnidarian/Geo-trinity/Trinity.fasta.transdecoder.pep 
-db /usr/local/bioinformatics/dbs/uniprot_sprot.fasta 
-evalue 1e-5 
-max_target_seqs 1 
-max_hsps 1 
-outfmt 6 
-num_threads 4 
-out /Volumes/web/cnidarian/Geo-trinity/Trinity.fasta.transdecoder.pep-blastp-uniprot-2.out

results: http://eagle.fish.washington.edu/cnidarian/Geo-trinity/Trinity.fasta.transdecoder.pep-blastp-uniprot-2.out

Share